Lineage for d3dina2 (3din A:619-816)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014124Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2014125Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) (S)
    automatically mapped to Pfam PF07516
  5. 2014126Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)
  6. 2014127Protein Helical scaffold and wing domains of SecA [81888] (3 species)
  7. 2014138Species Thermotoga maritima MSB8 [TaxId:243274] [267717] (1 PDB entry)
  8. 2014139Domain d3dina2: 3din A:619-816 [264722]
    Other proteins in same PDB: d3dina1, d3dina3, d3dina4, d3dinb1, d3dinb3, d3dinb4, d3dinc_, d3dind_, d3dine_, d3dinf_, d3ding_, d3dinh_
    complexed with adp, bef, mg

Details for d3dina2

PDB Entry: 3din (more details), 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase
PDB Compounds: (A:) Protein translocase subunit secA

SCOPe Domain Sequences for d3dina2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dina2 a.172.1.1 (A:619-816) Helical scaffold and wing domains of SecA {Thermotoga maritima MSB8 [TaxId: 243274]}
lsklieniqkkveginfsirktlmemddvldkqrravyslrdqillekdydeylkdifed
vvstrveefcsgknwdieslknslsffpaglfdldekqfssseelhdylfnrlweeyqrk
kqeigedyrkvirflmlriiddhwrryleevehvkeavqlrsygqkdpivefkketyymf
demmrrindtianyvlrv

SCOPe Domain Coordinates for d3dina2:

Click to download the PDB-style file with coordinates for d3dina2.
(The format of our PDB-style files is described here.)

Timeline for d3dina2: