SCOPe 2.07: Domain d3dina1: 3din A:271-392

Lineage for d3dina1 (3din A:271-392)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
   core: 4 helices: bundle; flanked by two short beta-hairpins
   duplication: consists of two structural repeats

4. Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family)
   automatically mapped to Pfam PF01043

5. Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)

6. Protein Pre-protein crosslinking domain of SecA [81769] (3 species)

7. Species Thermotoga maritima MSB8 [TaxId:243274] [267716] (1 PDB entry)

8. Domain d3dina1: 3din A:271-392 [264721]
   Other proteins in same PDB: d3dina2, d3dina3, d3dina4, d3dinb2, d3dinb3, d3dinb4, d3dinc_, d3dind_, d3dine_, d3dinf_, d3ding_, d3dinh_
   complexed with adp, bef, mg

Details for d3dina1

PDB Entry: 3din, 4.5 Å

PDB Description: crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase

PDB Compounds: (A:) Protein translocase subunit secA

SCOPe Domain Sequences for d3dina1:

Sequence; same for both SEQRES and ATOM records:

>d3dina1 a.162.1.1 (A:271-392) Pre-protein crosslinking domain of SecA {Thermotoga maritima MSB8 [TaxId: 243274]}
pskespsvyrrfaqiakkfvkdkdftvdekartiilteegvakaekiigvenlydpgnvs
llyhlinalkalhlfkkdvdyvvmngeviivdeftgrllpgrrysgglhqaieakegvpi
ke

Timeline for d3dina1:

• d3dina1 first appeared in SCOPe 2.05
  
• d3dina1 appears in SCOPe 2.06
  
• d3dina1 appears in the current release, SCOPe 2.08