SCOPe 2.02: Domain d1cowc2: 1cow C:19-94

Lineage for d1cowc2 (1cow C:19-94)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (14 PDB entries)
   Uniprot P19483

8. Domain d1cowc2: 1cow C:19-94 [26472]
   Other proteins in same PDB: d1cowa1, d1cowa3, d1cowb1, d1cowb3, d1cowc1, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_
   complexed with adp, anp, aur, mg

Details for d1cowc2

PDB Entry: 1cow, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

PDB Compounds: (C:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowc2:

Sequence; same for both SEQRES and ATOM records:

>d1cowc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

Timeline for d1cowc2:

• d1cowc2 first appeared (with stable ids) in SCOP 1.55
  
• d1cowc2 appears in SCOPe 2.01
  
• d1cowc2 appears in SCOPe 2.03
  
• d1cowc2 appears in the current release, SCOPe 2.08