Lineage for d3cere1 (3cer E:16-142)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138464Species Bifidobacterium longum [TaxId:206672] [267825] (1 PDB entry)
  8. 2138469Domain d3cere1: 3cer E:16-142 [264718]
    automated match to d1t6da1
    complexed with so4

Details for d3cere1

PDB Entry: 3cer (more details), 2.4 Å

PDB Description: crystal structure of the exopolyphosphatase-like protein q8g5j2. northeast structural genomics consortium target blr13
PDB Compounds: (E:) Possible exopolyphosphatase-like protein

SCOPe Domain Sequences for d3cere1:

Sequence, based on SEQRES records: (download)

>d3cere1 c.55.1.0 (E:16-142) automated matches {Bifidobacterium longum [TaxId: 206672]}
vtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealerayvaa
refagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadlsflga
tsvvnrd

Sequence, based on observed residues (ATOM records): (download)

>d3cere1 c.55.1.0 (E:16-142) automated matches {Bifidobacterium longum [TaxId: 206672]}
vtvagidcgtnsirlkiargmhevvprilrvirlgqdvdkthrfadealerayvaarefa
gviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadlsflgatsvv
nrd

SCOPe Domain Coordinates for d3cere1:

Click to download the PDB-style file with coordinates for d3cere1.
(The format of our PDB-style files is described here.)

Timeline for d3cere1: