Lineage for d3bsmc2 (3bsm C:114-388)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (73 species)
    not a true protein
  7. 2087559Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)
  8. 2087599Domain d3bsmc2: 3bsm C:114-388 [264711]
    Other proteins in same PDB: d3bsma1, d3bsma3, d3bsmb1, d3bsmb3, d3bsmc1, d3bsmc3, d3bsmd1, d3bsmd3
    automated match to d4il2a2

Details for d3bsmc2

PDB Entry: 3bsm (more details), 2.2 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bsmc2:

Sequence, based on SEQRES records: (download)

>d3bsmc2 c.1.11.0 (C:114-388) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypye

Sequence, based on observed residues (ATOM records): (download)

>d3bsmc2 c.1.11.0 (C:114-388) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgstekylnhapklfaavr
erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
aakypye

SCOPe Domain Coordinates for d3bsmc2:

Click to download the PDB-style file with coordinates for d3bsmc2.
(The format of our PDB-style files is described here.)

Timeline for d3bsmc2: