Lineage for d1cowb2 (1cow B:24-94)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61156Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 61157Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 61158Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 61162Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 61212Domain d1cowb2: 1cow B:24-94 [26471]
    Other proteins in same PDB: d1cowa1, d1cowa3, d1cowb1, d1cowb3, d1cowc1, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_

Details for d1cowb2

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

SCOP Domain Sequences for d1cowb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowb2 b.49.1.1 (B:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1cowb2:

Click to download the PDB-style file with coordinates for d1cowb2.
(The format of our PDB-style files is described here.)

Timeline for d1cowb2: