| Class b: All beta proteins [48724] (93 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
| Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [50618] (7 PDB entries) |
| Domain d1cowb2: 1cow B:24-94 [26471] Other proteins in same PDB: d1cowa1, d1cowa3, d1cowb1, d1cowb3, d1cowc1, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_ |
PDB Entry: 1cow (more details), 3.1 Å
SCOP Domain Sequences for d1cowb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowb2 b.49.1.1 (B:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai
Timeline for d1cowb2: