Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries) |
Domain d3bsmb2: 3bsm B:114-388 [264709] Other proteins in same PDB: d3bsma1, d3bsma3, d3bsmb1, d3bsmb3, d3bsmc1, d3bsmc3, d3bsmd1, d3bsmd3 automated match to d4il2a2 |
PDB Entry: 3bsm (more details), 2.2 Å
SCOPe Domain Sequences for d3bsmb2:
Sequence, based on SEQRES records: (download)
>d3bsmb2 c.1.11.0 (B:114-388) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypye
>d3bsmb2 c.1.11.0 (B:114-388) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgstekylnhapklfaavr erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel aakypye
Timeline for d3bsmb2: