SCOPe 2.06: Domain d3bsmb1: 3bsm B:4-113

Lineage for d3bsmb1 (3bsm B:4-113)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)

8. Domain d3bsmb1: 3bsm B:4-113 [264708]
   Other proteins in same PDB: d3bsma2, d3bsma3, d3bsmb2, d3bsmb3, d3bsmc2, d3bsmc3, d3bsmd2, d3bsmd3
   automated match to d4il2a1

Details for d3bsmb1

PDB Entry: 3bsm, 2.2 Å

PDB Description: crystal structure of d-mannonate dehydratase from chromohalobacter salexigens

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bsmb1:

Sequence; same for both SEQRES and ATOM records:

>d3bsmb1 d.54.1.0 (B:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

Timeline for d3bsmb1:

• d3bsmb1 first appeared in SCOPe 2.05
  
• d3bsmb1 appears in SCOPe 2.07
  
• d3bsmb1 appears in the current release, SCOPe 2.08