| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
| Protein automated matches [190646] (77 species) not a true protein |
| Species Chloroflexus aggregans [TaxId:326427] [267824] (1 PDB entry) |
| Domain d3bbla1: 3bbl A:63-338 [264705] Other proteins in same PDB: d3bbla2, d3bbla3 automated match to d3ctpa_ complexed with edo |
PDB Entry: 3bbl (more details), 2.35 Å
SCOPe Domain Sequences for d3bbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbla1 c.93.1.0 (A:63-338) automated matches {Chloroflexus aggregans [TaxId: 326427]}
sfmigyswtqtepgqvnhildqflssmvreagavnyfvlpfpfsedrsqidiyrdlirsg
nvdgfvlssinyndprvqfllkqkfpfvafgrsnpdwdfawvdidgtagtrqaveyligr
ghrriailawpedsrvgndrlqgyleamqtaqlpietgyilrgegtfevgramtlhlldl
sperrptaimtlndtmaigamaaarergltigtdlaiigfddapmvqylfpplssvrqpi
aeagrkciellvaivegrepeqkhillqpsliiras
Timeline for d3bbla1: