SCOPe 2.08: Domain d3bbla1: 3bbl A:63-338

Lineage for d3bbla1 (3bbl A:63-338)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Chloroflexus aggregans [TaxId:326427] [267824] (1 PDB entry)

8. Domain d3bbla1: 3bbl A:63-338 [264705]
   Other proteins in same PDB: d3bbla2, d3bbla3
   automated match to d3ctpa_
   complexed with edo

Details for d3bbla1

PDB Entry: 3bbl, 2.35 Å

PDB Description: crystal structure of a regulatory protein of laci family from chloroflexus aggregans

PDB Compounds: (A:) Regulatory protein of LacI family

SCOPe Domain Sequences for d3bbla1:

Sequence; same for both SEQRES and ATOM records:

>d3bbla1 c.93.1.0 (A:63-338) automated matches {Chloroflexus aggregans [TaxId: 326427]}
sfmigyswtqtepgqvnhildqflssmvreagavnyfvlpfpfsedrsqidiyrdlirsg
nvdgfvlssinyndprvqfllkqkfpfvafgrsnpdwdfawvdidgtagtrqaveyligr
ghrriailawpedsrvgndrlqgyleamqtaqlpietgyilrgegtfevgramtlhlldl
sperrptaimtlndtmaigamaaarergltigtdlaiigfddapmvqylfpplssvrqpi
aeagrkciellvaivegrepeqkhillqpsliiras

Timeline for d3bbla1:

• d3bbla1 first appeared in SCOPe 2.05, called d3bbla_
  
• d3bbla1 appears in SCOPe 2.07