Class b: All beta proteins [48724] (141 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88673] (10 PDB entries) |
Domain d1cowa2: 1cow A:24-94 [26470] Other proteins in same PDB: d1cowa1, d1cowa3, d1cowb1, d1cowb3, d1cowc1, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_ |
PDB Entry: 1cow (more details), 3.1 Å
SCOP Domain Sequences for d1cowa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowa2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d1cowa2: