![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.37: Clostridium perfringens enterotoxin (CPE), C-terminal domain [267611] (2 proteins) C-terminal part of Pfam PF03505; PubMed 17977833 describes homology between (d2quoa_), (d1w99a3), and (d1nqdb_) |
![]() | Protein Clostridium perfringens enterotoxin (CPE), C-terminal domain [267649] (1 species) |
![]() | Species Clostridium perfringens [TaxId:1502] [267714] (3 PDB entries) |
![]() | Domain d3am2a1: 3am2 A:200-319 [264699] Other proteins in same PDB: d3am2a2, d3am2a3 complexed with gol, unx |
PDB Entry: 3am2 (more details), 2.51 Å
SCOPe Domain Sequences for d3am2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3am2a1 b.18.1.37 (A:200-319) Clostridium perfringens enterotoxin (CPE), C-terminal domain {Clostridium perfringens [TaxId: 1502]} ldlaaaterlnltdalnsnpagnlydwrssnsypwtqklnlhltitatgqkyrilaskiv dfniysnnfnnlvkleqslgdgvkdhyvdisldagqyvlvmkanssysgnypysilfqkf
Timeline for d3am2a1: