Lineage for d3ak3c2 (3ak3 C:93-210)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903862Species Aeropyrum pernix [TaxId:272557] [267822] (3 PDB entries)
  8. 1903869Domain d3ak3c2: 3ak3 C:93-210 [264696]
    Other proteins in same PDB: d3ak3a1, d3ak3b1, d3ak3c1, d3ak3d1
    automated match to d1p7ga2
    complexed with edo, fe

Details for d3ak3c2

PDB Entry: 3ak3 (more details), 1.48 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, Fe-bound form
PDB Compounds: (C:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ak3c2 d.44.1.0 (C:93-210) automated matches {Aeropyrum pernix [TaxId: 272557]}
ggtpggrvadliekqfggfekfkalfsaaaktvegvgwgvlafdplteelrilqvekhnv
lmtaglvpilvidvwehayylqykndrgsyvenwwnvvnwddvekrleqalnnakply

SCOPe Domain Coordinates for d3ak3c2:

Click to download the PDB-style file with coordinates for d3ak3c2.
(The format of our PDB-style files is described here.)

Timeline for d3ak3c2: