SCOPe 2.08: Domain d3ak3c2: 3ak3 C:93-210

Lineage for d3ak3c2 (3ak3 C:93-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [267822] (3 PDB entries)

8. Domain d3ak3c2: 3ak3 C:93-210 [264696]
   Other proteins in same PDB: d3ak3a1, d3ak3b1, d3ak3c1, d3ak3d1
   automated match to d1p7ga2
   complexed with edo, fe

Details for d3ak3c2

PDB Entry: 3ak3, 1.48 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, Fe-bound form

PDB Compounds: (C:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak3c2:

Sequence; same for both SEQRES and ATOM records:

>d3ak3c2 d.44.1.0 (C:93-210) automated matches {Aeropyrum pernix [TaxId: 272557]}
ggtpggrvadliekqfggfekfkalfsaaaktvegvgwgvlafdplteelrilqvekhnv
lmtaglvpilvidvwehayylqykndrgsyvenwwnvvnwddvekrleqalnnakply

Timeline for d3ak3c2:

• d3ak3c2 first appeared in SCOPe 2.05
  
• d3ak3c2 appears in SCOPe 2.07