SCOPe 2.08: Domain d3ak3b1: 3ak3 B:1-92

Lineage for d3ak3b1 (3ak3 B:1-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [267821] (3 PDB entries)

8. Domain d3ak3b1: 3ak3 B:1-92 [264693]
   Other proteins in same PDB: d3ak3a2, d3ak3b2, d3ak3c2, d3ak3d2
   automated match to d1p7ga1
   complexed with edo, fe

Details for d3ak3b1

PDB Entry: 3ak3, 1.48 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, Fe-bound form

PDB Compounds: (B:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak3b1:

Sequence; same for both SEQRES and ATOM records:

>d3ak3b1 a.2.11.0 (B:1-92) automated matches {Aeropyrum pernix [TaxId: 272557]}
mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
dvravmrdfsfnyaghimhtifwpnmappgkg

Timeline for d3ak3b1:

• d3ak3b1 first appeared in SCOPe 2.05
  
• d3ak3b1 appears in SCOPe 2.07