Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [267821] (3 PDB entries) |
Domain d3ak3b1: 3ak3 B:1-92 [264693] Other proteins in same PDB: d3ak3a2, d3ak3b2, d3ak3c2, d3ak3d2 automated match to d1p7ga1 complexed with edo, fe |
PDB Entry: 3ak3 (more details), 1.48 Å
SCOPe Domain Sequences for d3ak3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ak3b1 a.2.11.0 (B:1-92) automated matches {Aeropyrum pernix [TaxId: 272557]} mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi dvravmrdfsfnyaghimhtifwpnmappgkg
Timeline for d3ak3b1: