Lineage for d3ak2d1 (3ak2 D:2-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690356Species Aeropyrum pernix [TaxId:272557] [267821] (3 PDB entries)
  8. 2690360Domain d3ak2d1: 3ak2 D:2-92 [264689]
    Other proteins in same PDB: d3ak2a2, d3ak2b2, d3ak2c2, d3ak2d2
    automated match to d1p7ga1
    complexed with edo, mn

Details for d3ak2d1

PDB Entry: 3ak2 (more details), 1.35 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, Mn-bound form
PDB Compounds: (D:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ak2d1 a.2.11.0 (D:2-92) automated matches {Aeropyrum pernix [TaxId: 272557]}
vsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqid
vravmrdfsfnyaghimhtifwpnmappgkg

SCOPe Domain Coordinates for d3ak2d1:

Click to download the PDB-style file with coordinates for d3ak2d1.
(The format of our PDB-style files is described here.)

Timeline for d3ak2d1: