| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Aeropyrum pernix [TaxId:272557] [267821] (3 PDB entries) |
| Domain d3ak2c1: 3ak2 C:1-92 [264687] Other proteins in same PDB: d3ak2a2, d3ak2b2, d3ak2c2, d3ak2d2 automated match to d1p7ga1 complexed with edo, mn |
PDB Entry: 3ak2 (more details), 1.35 Å
SCOPe Domain Sequences for d3ak2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ak2c1 a.2.11.0 (C:1-92) automated matches {Aeropyrum pernix [TaxId: 272557]}
mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
dvravmrdfsfnyaghimhtifwpnmappgkg
Timeline for d3ak2c1: