SCOP 1.55: Domain d1efre2: 1efr E:9-81

Lineage for d1efre2 (1efr E:9-81)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (7 PDB entries)

8. Domain d1efre2: 1efr E:9-81 [26468]
   Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_

Details for d1efre2

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efre2:

Sequence; same for both SEQRES and ATOM records:

>d1efre2 b.49.1.1 (E:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1efre2:

• d1efre2 appears in SCOP 1.57
  
• d1efre2 appears in the current release, SCOPe 2.08