Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (31 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [267822] (3 PDB entries) |
Domain d3ak1b2: 3ak1 B:93-213 [264678] Other proteins in same PDB: d3ak1a1, d3ak1b1, d3ak1c1, d3ak1d1 automated match to d1p7ga2 complexed with edo |
PDB Entry: 3ak1 (more details), 1.57 Å
SCOPe Domain Sequences for d3ak1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ak1b2 d.44.1.0 (B:93-213) automated matches {Aeropyrum pernix [TaxId: 272557]} ggtpggrvadliekqfggfekfkalfsaaaktvegvgwgvlafdplteelrilqvekhnv lmtaglvpilvidvwehayylqykndrgsyvenwwnvvnwddvekrleqalnnakplyll p
Timeline for d3ak1b2: