SCOPe 2.08: Domain d3afif1: 3afi F:10-306

Lineage for d3afif1 (3afi F:10-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:224911] [267820] (1 PDB entry)

8. Domain d3afif1: 3afi F:10-306 [264674]
   Other proteins in same PDB: d3afia2, d3afib2, d3afie2, d3afif2
   automated match to d4k2ac_
   complexed with cl

Details for d3afif1

PDB Entry: 3afi, 1.75 Å

PDB Description: crystal structure of dbja (his-dbja)

PDB Compounds: (F:) haloalkane dehalogenase

SCOPe Domain Sequences for d3afif1:

Sequence; same for both SEQRES and ATOM records:

>d3afif1 c.69.1.0 (F:10-306) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrp

Timeline for d3afif1:

• d3afif1 first appeared in SCOPe 2.05
  
• d3afif1 appears in SCOPe 2.07