Lineage for d3afie1 (3afi E:10-307)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902024Species Bradyrhizobium japonicum [TaxId:224911] [267820] (1 PDB entry)
  8. 2902027Domain d3afie1: 3afi E:10-307 [264673]
    Other proteins in same PDB: d3afia2, d3afib2, d3afie2, d3afif2
    automated match to d4k2ac_
    complexed with cl

Details for d3afie1

PDB Entry: 3afi (more details), 1.75 Å

PDB Description: crystal structure of dbja (his-dbja)
PDB Compounds: (E:) haloalkane dehalogenase

SCOPe Domain Sequences for d3afie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3afie1 c.69.1.0 (E:10-307) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq

SCOPe Domain Coordinates for d3afie1:

Click to download the PDB-style file with coordinates for d3afie1.
(The format of our PDB-style files is described here.)

Timeline for d3afie1: