![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Bradyrhizobium japonicum [TaxId:224911] [267820] (1 PDB entry) |
![]() | Domain d3afie1: 3afi E:10-307 [264673] Other proteins in same PDB: d3afia2, d3afib2, d3afie2, d3afif2 automated match to d4k2ac_ complexed with cl |
PDB Entry: 3afi (more details), 1.75 Å
SCOPe Domain Sequences for d3afie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3afie1 c.69.1.0 (E:10-307) automated matches {Bradyrhizobium japonicum [TaxId: 224911]} rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq
Timeline for d3afie1: