Lineage for d3a68l_ (3a68 L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1992464Species Soybean (Glycine max) [TaxId:3847] [255741] (2 PDB entries)
  8. 1992476Domain d3a68l_: 3a68 L: [264670]
    automated match to d3a9qe_
    complexed with acy, ca

Details for d3a68l_

PDB Entry: 3a68 (more details), 1.8 Å

PDB Description: Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
PDB Compounds: (L:) Ferritin-4, chloroplastic

SCOPe Domain Sequences for d3a68l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a68l_ a.25.1.0 (L:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
lalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgkg
hgvwhfdqmllhe

SCOPe Domain Coordinates for d3a68l_:

Click to download the PDB-style file with coordinates for d3a68l_.
(The format of our PDB-style files is described here.)

Timeline for d3a68l_: