Lineage for d3a2ne_ (3a2n E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902029Species Bradyrhizobium japonicum [TaxId:375] [267819] (3 PDB entries)
  8. 2902034Domain d3a2ne_: 3a2n E: [264666]
    automated match to d4k2aa_
    complexed with cl

Details for d3a2ne_

PDB Entry: 3a2n (more details), 1.89 Å

PDB Description: Crystal structure of DBJA (Wild Type Type II P21)
PDB Compounds: (E:) haloalkane dehalogenase

SCOPe Domain Sequences for d3a2ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a2ne_ c.69.1.0 (E:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq

SCOPe Domain Coordinates for d3a2ne_:

Click to download the PDB-style file with coordinates for d3a2ne_.
(The format of our PDB-style files is described here.)

Timeline for d3a2ne_: