SCOPe 2.07: Domain d3a2ma_: 3a2m A:

Lineage for d3a2ma_ (3a2m A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (103 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:375] [267819] (3 PDB entries)

8. Domain d3a2ma_: 3a2m A: [264662]
   automated match to d4k2aa_
   complexed with cl, suc

Details for d3a2ma_

PDB Entry: 3a2m, 1.84 Å

PDB Description: crystal structure of dbja (wild type type i)

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d3a2ma_:

Sequence; same for both SEQRES and ATOM records:

>d3a2ma_ c.69.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
eirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfg
qsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafme
firpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivr
klgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllf
tgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavr

Timeline for d3a2ma_:

• d3a2ma_ first appeared in SCOPe 2.05
  
• d3a2ma_ appears in SCOPe 2.06