| Class b: All beta proteins [48724] (126 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88673] (10 PDB entries) |
| Domain d1efrc2: 1efr C:19-94 [26466] Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3, d1efrg_ complexed with adp, anp, app, bal, cpi, mg, tlx |
PDB Entry: 1efr (more details), 3.1 Å
SCOP Domain Sequences for d1efrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efrc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai
Timeline for d1efrc2: