![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
![]() | Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries) |
![]() | Domain d1efrb2: 1efr B:24-94 [26465] Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_ |
PDB Entry: 1efr (more details), 3.1 Å
SCOP Domain Sequences for d1efrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efrb2 b.49.1.1 (B:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d1efrb2: