Lineage for d1efra2 (1efr A:24-94)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231263Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 231264Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 231265Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 231266Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  7. 231270Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 231307Domain d1efra2: 1efr A:24-94 [26464]
    Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_

Details for d1efra2

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efra2 b.49.1.1 (A:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1efra2:

Click to download the PDB-style file with coordinates for d1efra2.
(The format of our PDB-style files is described here.)

Timeline for d1efra2: