SCOP 1.59: Domain d1efra2: 1efr A:24-94

Lineage for d1efra2 (1efr A:24-94)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)

8. Domain d1efra2: 1efr A:24-94 [26464]
   Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_

Details for d1efra2

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efra2:

Sequence; same for both SEQRES and ATOM records:

>d1efra2 b.49.1.1 (A:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1efra2:

• d1efra2 first appeared (with stable ids) in SCOP 1.55
  
• d1efra2 appears in SCOP 1.57
  
• d1efra2 appears in SCOP 1.61
  
• d1efra2 appears in the current release, SCOPe 2.08