SCOPe 2.07: Domain d2zzwb_: 2zzw B:

Lineage for d2zzwb_ (2zzw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (146 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [226637] (8 PDB entries)

8. Domain d2zzwb_: 2zzw B: [264639]
   automated match to d2zzxc_
   complexed with lac, zn

Details for d2zzwb_

PDB Entry: 2zzw, 1.95 Å

PDB Description: Crystal Structure of a Periplasmic Substrate Binding Protein in Complex with Zinc and Lactate

PDB Compounds: (B:) ABC transporter, solute-binding protein

SCOPe Domain Sequences for d2zzwb_:

Sequence; same for both SEQRES and ATOM records:

>d2zzwb_ c.94.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rryrwriqtawdagtvgyslfqkftervkeltdgqlevqpfpagavvgtfdmfdavktgv
ldgmnpftlywagrmpvtaflssyalgldrpdqwetwfyslggldiarrafaeqglfyvg
pvqhdlniihskkpirrfedfkgvklrvpggmiaevfaaagastvllpggevypalergv
idaadfvgpavnynlgfhqvakyiimgppetpaihqpvdlmdftinlnrwrslpkplqer
fiaavheyswihyagiqkanleawpkyrqagvevirlsnedvrkfrrlaipiwfkwakmd
kysreafasqleymkgigyvtdeelkglsl

Timeline for d2zzwb_:

• d2zzwb_ first appeared in SCOPe 2.05
  
• d2zzwb_ appears in SCOPe 2.06