SCOPe 2.08: Domain d2znra1: 2znr A:264-436

Lineage for d2znra1 (2znr A:264-436)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
   Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)

6. Protein automated matches [267675] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267818] (2 PDB entries)

8. Domain d2znra1: 2znr A:264-436 [264635]
   Other proteins in same PDB: d2znra2
   automated match to d3rzuc_
   complexed with edo, pr, zn

Details for d2znra1

PDB Entry: 2znr, 1.2 Å

PDB Description: Crystal structure of the DUB domain of human AMSH-LP

PDB Compounds: (A:) AMSH-like protease

SCOPe Domain Sequences for d2znra1:

Sequence; same for both SEQRES and ATOM records:

>d2znra1 c.97.3.1 (A:264-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eglrcvvlpedlchkflqlaesntvrgietcgilcgklthneftithvivpkqsagpdyc
dmenveelfnvqdqhdlltlgwihthptqtaflssvdlhthcsyqlmlpeaiaivcspkh
kdtgifrltnagmlevsackkkgfhphtkeprlfsickhvlvkdikiivldlr

Timeline for d2znra1:

• d2znra1 first appeared in SCOPe 2.05, called d2znra_
  
• d2znra1 appears in SCOPe 2.07