Lineage for d2z8gb2 (2z8g B:185-564)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069351Family b.80.1.0: automated matches [191490] (1 protein)
    not a true family
  6. 2069352Protein automated matches [190791] (5 species)
    not a true protein
  7. 2069353Species Aspergillus niger [TaxId:5061] [261058] (4 PDB entries)
  8. 2069355Domain d2z8gb2: 2z8g B:185-564 [264634]
    Other proteins in same PDB: d2z8ga1, d2z8ga3, d2z8gb1, d2z8gb3
    automated match to d3wwgb2
    complexed with nag

Details for d2z8gb2

PDB Entry: 2z8g (more details), 1.7 Å

PDB Description: Aspergillus niger ATCC9642 isopullulanase complexed with isopanose
PDB Compounds: (B:) Isopullulanase

SCOPe Domain Sequences for d2z8gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8gb2 b.80.1.0 (B:185-564) automated matches {Aspergillus niger [TaxId: 5061]}
ensstkpqpgspnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfa
pgayvkgaveflstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlg
nssqtfvlngvtvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilq
dvfyhtdddglkmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayan
agnnpgifgavnnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnl
dnisiknvsiesfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaa
svgridgvdpayagsvhyid

SCOPe Domain Coordinates for d2z8gb2:

Click to download the PDB-style file with coordinates for d2z8gb2.
(The format of our PDB-style files is described here.)

Timeline for d2z8gb2: