Lineage for d2z8gb1 (2z8g B:20-184)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824608Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2824609Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families) (S)
  5. 2824615Family b.133.1.0: automated matches [261054] (1 protein)
    not a true family
  6. 2824616Protein automated matches [261055] (1 species)
    not a true protein
  7. 2824617Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries)
  8. 2824621Domain d2z8gb1: 2z8g B:20-184 [264633]
    Other proteins in same PDB: d2z8ga2, d2z8ga3, d2z8gb2, d2z8gb3
    automated match to d3wwgb1
    complexed with nag

Details for d2z8gb1

PDB Entry: 2z8g (more details), 1.7 Å

PDB Description: aspergillus niger atcc9642 isopullulanase complexed with isopanose
PDB Compounds: (B:) Isopullulanase

SCOPe Domain Sequences for d2z8gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8gb1 b.133.1.0 (B:20-184) automated matches {Aspergillus niger [TaxId: 5061]}
avtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvylaip
gngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvrydnq
svyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

SCOPe Domain Coordinates for d2z8gb1:

Click to download the PDB-style file with coordinates for d2z8gb1.
(The format of our PDB-style files is described here.)

Timeline for d2z8gb1: