Class b: All beta proteins [48724] (180 folds) |
Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families) |
Family b.133.1.0: automated matches [261054] (1 protein) not a true family |
Protein automated matches [261055] (1 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries) |
Domain d2z8gb1: 2z8g B:20-184 [264633] Other proteins in same PDB: d2z8ga2, d2z8ga3, d2z8gb2, d2z8gb3 automated match to d3wwgb1 complexed with nag |
PDB Entry: 2z8g (more details), 1.7 Å
SCOPe Domain Sequences for d2z8gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8gb1 b.133.1.0 (B:20-184) automated matches {Aspergillus niger [TaxId: 5061]} avtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvylaip gngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvrydnq svyitvpysptgyrfsvefdddlislapsgarqpenallifaspf
Timeline for d2z8gb1: