SCOPe 2.05: Domain d2z8ga2: 2z8g A:185-564

Lineage for d2z8ga2 (2z8g A:185-564)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.0: automated matches [191490] (1 protein)
   not a true family

6. Protein automated matches [190791] (5 species)
   not a true protein

7. Species Aspergillus niger [TaxId:5061] [261058] (4 PDB entries)

8. Domain d2z8ga2: 2z8g A:185-564 [264632]
   Other proteins in same PDB: d2z8ga1, d2z8gb1
   automated match to d3wwgb2
   complexed with nag

Details for d2z8ga2

PDB Entry: 2z8g, 1.7 Å

PDB Description: aspergillus niger atcc9642 isopullulanase complexed with isopanose

PDB Compounds: (A:) Isopullulanase

SCOPe Domain Sequences for d2z8ga2:

Sequence; same for both SEQRES and ATOM records:

>d2z8ga2 b.80.1.0 (A:185-564) automated matches {Aspergillus niger [TaxId: 5061]}
ensstkpqpgspnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfa
pgayvkgaveflstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlg
nssqtfvlngvtvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilq
dvfyhtdddglkmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayan
agnnpgifgavnnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnl
dnisiknvsiesfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaa
svgridgvdpayagsvhyid

Timeline for d2z8ga2:

• d2z8ga2 is new in SCOPe 2.05-stable
  
• d2z8ga2 appears in SCOPe 2.06
  
• d2z8ga2 appears in the current release, SCOPe 2.08