Lineage for d2z8ga1 (2z8g A:16-184)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814335Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 1814336Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families) (S)
  5. 1814342Family b.133.1.0: automated matches [261054] (1 protein)
    not a true family
  6. 1814343Protein automated matches [261055] (1 species)
    not a true protein
  7. 1814344Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries)
  8. 1814345Domain d2z8ga1: 2z8g A:16-184 [264631]
    Other proteins in same PDB: d2z8ga2, d2z8gb2
    automated match to d3wwgb1
    complexed with nag

Details for d2z8ga1

PDB Entry: 2z8g (more details), 1.7 Å

PDB Description: Aspergillus niger ATCC9642 isopullulanase complexed with isopanose
PDB Compounds: (A:) Isopullulanase

SCOPe Domain Sequences for d2z8ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8ga1 b.133.1.0 (A:16-184) automated matches {Aspergillus niger [TaxId: 5061]}
refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

SCOPe Domain Coordinates for d2z8ga1:

Click to download the PDB-style file with coordinates for d2z8ga1.
(The format of our PDB-style files is described here.)

Timeline for d2z8ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z8ga2