Lineage for d1e1qf2 (1e1q F:9-81)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15612Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 15613Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 15614Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 15615Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (3 species)
  7. 15619Species Cow (Bos taurus) [TaxId:9913] [50618] (7 PDB entries)
  8. 15643Domain d1e1qf2: 1e1q F:9-81 [26463]
    Other proteins in same PDB: d1e1qa1, d1e1qa3, d1e1qb1, d1e1qb3, d1e1qc1, d1e1qc3, d1e1qd1, d1e1qd3, d1e1qe1, d1e1qe3, d1e1qf1, d1e1qf3, d1e1qg_

Details for d1e1qf2

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qf2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1e1qf2:

Click to download the PDB-style file with coordinates for d1e1qf2.
(The format of our PDB-style files is described here.)

Timeline for d1e1qf2: