Lineage for d2z1zb_ (2z1z B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132954Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (10 PDB entries)
  8. 2132974Domain d2z1zb_: 2z1z B: [264627]
    automated match to d4my5a_
    complexed with mlt, plp

Details for d2z1zb_

PDB Entry: 2z1z (more details), 2.4 Å

PDB Description: Crystal structure of LL-Diaminopimelate Aminotransferase from Arabidopsis thaliana complexed with L-malate ion
PDB Compounds: (B:) LL-diaminopimelate aminotransferase

SCOPe Domain Sequences for d2z1zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z1zb_ c.67.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlyk

SCOPe Domain Coordinates for d2z1zb_:

Click to download the PDB-style file with coordinates for d2z1zb_.
(The format of our PDB-style files is described here.)

Timeline for d2z1zb_: