Lineage for d2yy7a_ (2yy7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846887Species Flavobacterium frigidimaris [TaxId:262320] [267815] (1 PDB entry)
  8. 2846888Domain d2yy7a_: 2yy7 A: [264621]
    automated match to d3sxpa_
    complexed with gol, mes, nad, pe8

Details for d2yy7a_

PDB Entry: 2yy7 (more details), 2.06 Å

PDB Description: Crystal structure of thermolabile L-threonine dehydrogenase from Flavobacterium frigidimaris KUC-1
PDB Compounds: (A:) L-threonine dehydrogenase

SCOPe Domain Sequences for d2yy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yy7a_ c.2.1.0 (A:) automated matches {Flavobacterium frigidimaris [TaxId: 262320]}
mnpkiliigacgqigteltqklrklygtenviasdirklntdvvnsgpfevvnaldfnqi
ehlvevhkitdiylmaallsataeknpafawdlnmnslfhvlnlakakkikkifwpssia
vfgpttpkentpqytimepstvygiskqagerwceyyhniygvdvrsirypgliswstpp
gggttdyavdifykaiadkkyecflssetkmpmmymddaidatinimkapvekikihssy
nlaamsftpteianeikkhipeftityepdfrqkiadswpasiddsqaredwdwkhtfdl
esmtkdmiehls

SCOPe Domain Coordinates for d2yy7a_:

Click to download the PDB-style file with coordinates for d2yy7a_.
(The format of our PDB-style files is described here.)

Timeline for d2yy7a_: