Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries) Uniprot P00829 |
Domain d1e1qe2: 1e1q E:9-81 [26462] Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd1, d1e1qd3, d1e1qe1, d1e1qe3, d1e1qf1, d1e1qf3, d1e1qg_ |
PDB Entry: 1e1q (more details), 2.61 Å
SCOP Domain Sequences for d1e1qe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1qe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1e1qe2: