SCOP 1.75: Domain d1e1qe2: 1e1q E:9-81

Lineage for d1e1qe2 (1e1q E:9-81)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)
   Uniprot P00829

8. Domain d1e1qe2: 1e1q E:9-81 [26462]
   Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd1, d1e1qd3, d1e1qe1, d1e1qe3, d1e1qf1, d1e1qf3, d1e1qg_

Details for d1e1qe2

PDB Entry: 1e1q, 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

PDB Compounds: (E:) bovine mitochondrial f1-ATPase

SCOP Domain Sequences for d1e1qe2:

Sequence; same for both SEQRES and ATOM records:

>d1e1qe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1e1qe2:

• d1e1qe2 first appeared (with stable ids) in SCOP 1.55
  
• d1e1qe2 appears in SCOP 1.73
  
• d1e1qe2 appears in SCOPe 2.01
  
• d1e1qe2 appears in the current release, SCOPe 2.08