SCOPe 2.07: Domain d2yd7b1: 2yd7 B:21-114

Lineage for d2yd7b1 (2yd7 B:21-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2yd7b1: 2yd7 B:21-114 [264610]
   automated match to d2yd3a1
   complexed with po4

Details for d2yd7b1

PDB Entry: 2yd7, 1.98 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase delta

PDB Compounds: (B:) ptprd protein

SCOPe Domain Sequences for d2yd7b1:

Sequence; same for both SEQRES and ATOM records:

>d2yd7b1 b.1.1.0 (B:21-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddgsgs
vlriqplrtprdeaiyecvasnnvgeisvstrlt

Timeline for d2yd7b1:

• d2yd7b1 first appeared in SCOPe 2.05
  
• d2yd7b1 appears in SCOPe 2.06
  
• d2yd7b1 appears in the current release, SCOPe 2.08