Lineage for d1e1qd2 (1e1q D:9-81)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798680Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2798729Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 2798778Domain d1e1qd2: 1e1q D:9-81 [26461]
    Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd1, d1e1qd3, d1e1qe1, d1e1qe3, d1e1qf1, d1e1qf3, d1e1qg_
    complexed with adp, anp, mg, po4

Details for d1e1qd2

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k
PDB Compounds: (D:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1qd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qd2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1e1qd2:

Click to download the PDB-style file with coordinates for d1e1qd2.
(The format of our PDB-style files is described here.)

Timeline for d1e1qd2: