| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d2yd6a2: 2yd6 A:115-220 [264607] Other proteins in same PDB: d2yd6a3 automated match to d2yd3a2 complexed with cl, flc |
PDB Entry: 2yd6 (more details), 1.35 Å
SCOPe Domain Sequences for d2yd6a2:
Sequence, based on SEQRES records: (download)
>d2yd6a2 b.1.1.0 (A:115-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdtsnnngr
ikqlrsesigalqieqseesdqgkyecvatnsagtrysapanlyvr
>d2yd6a2 b.1.1.0 (A:115-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvgrikqlrs
esigalqieqseesdqgkyecvatnsagtrysapanlyvr
Timeline for d2yd6a2: