Lineage for d2yd6a2 (2yd6 A:115-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754293Domain d2yd6a2: 2yd6 A:115-220 [264607]
    Other proteins in same PDB: d2yd6a3
    automated match to d2yd3a2
    complexed with cl, flc

Details for d2yd6a2

PDB Entry: 2yd6 (more details), 1.35 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase delta
PDB Compounds: (A:) ptprd protein

SCOPe Domain Sequences for d2yd6a2:

Sequence, based on SEQRES records: (download)

>d2yd6a2 b.1.1.0 (A:115-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdtsnnngr
ikqlrsesigalqieqseesdqgkyecvatnsagtrysapanlyvr

Sequence, based on observed residues (ATOM records): (download)

>d2yd6a2 b.1.1.0 (A:115-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvgrikqlrs
esigalqieqseesdqgkyecvatnsagtrysapanlyvr

SCOPe Domain Coordinates for d2yd6a2:

Click to download the PDB-style file with coordinates for d2yd6a2.
(The format of our PDB-style files is described here.)

Timeline for d2yd6a2: