![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
![]() | Protein automated matches [190781] (46 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [267813] (6 PDB entries) |
![]() | Domain d2xrfb_: 2xrf B: [264599] automated match to d4r31e_ complexed with gol, mg, ura |
PDB Entry: 2xrf (more details), 2.3 Å
SCOPe Domain Sequences for d2xrfb_:
Sequence, based on SEQRES records: (download)
>d2xrfb_ c.56.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkel gfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvti irigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncske ipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaa mcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlgl
>d2xrfb_ c.56.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkel gfeikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigt sggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfp tlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglc glkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlgl
Timeline for d2xrfb_: