Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [267812] (1 PDB entry) |
Domain d2xh6c2: 2xh6 C:200-319 [264597] Other proteins in same PDB: d2xh6a1, d2xh6b1, d2xh6c1 automated match to d3am2a1 complexed with bog, dio |
PDB Entry: 2xh6 (more details), 2.69 Å
SCOPe Domain Sequences for d2xh6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xh6c2 b.18.1.0 (C:200-319) automated matches {Clostridium perfringens [TaxId: 1502]} ldlaaaterlnltdalnsnpagnlydwrssnsypwtqklnlhltitatgqkyrilaskiv dfniysnnfnnlvkleqslgdgvkdhyvdisldagqyvlvmkanssysgnypysilfqkf
Timeline for d2xh6c2:
View in 3D Domains from other chains: (mouse over for more information) d2xh6a1, d2xh6a2, d2xh6b1, d2xh6b2 |