![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:1502] [267812] (1 PDB entry) |
![]() | Domain d2xh6a2: 2xh6 A:200-319 [264593] Other proteins in same PDB: d2xh6a1, d2xh6b1, d2xh6c1 automated match to d3am2a1 complexed with bog, dio |
PDB Entry: 2xh6 (more details), 2.69 Å
SCOPe Domain Sequences for d2xh6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xh6a2 b.18.1.0 (A:200-319) automated matches {Clostridium perfringens [TaxId: 1502]} ldlaaaterlnltdalnsnpagnlydwrssnsypwtqklnlhltitatgqkyrilaskiv dfniysnnfnnlvkleqslgdgvkdhyvdisldagqyvlvmkanssysgnypysilfqkf
Timeline for d2xh6a2:
![]() Domains from other chains: (mouse over for more information) d2xh6b1, d2xh6b2, d2xh6c1, d2xh6c2 |