SCOPe 2.06: Domain d2xaqb1: 2xaq B:308-375

Lineage for d2xaqb1 (2xaq B:308-375)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family)
   Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1

5. Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)

6. Protein Demethylase interaction domain of CoREST [267660] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries)

8. Domain d2xaqb1: 2xaq B:308-375 [264585]
   Other proteins in same PDB: d2xaqa1, d2xaqa2, d2xaqa3, d2xaqb2
   complexed with fad, m84

Details for d2xaqb1

PDB Entry: 2xaq, 3.2 Å

PDB Description: crystal structure of lsd1-corest in complex with a tranylcypromine derivative (mc2584, 13b)

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xaqb1:

Sequence; same for both SEQRES and ATOM records:

>d2xaqb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

Timeline for d2xaqb1:

• d2xaqb1 first appeared in SCOPe 2.05
  
• d2xaqb1 appears in SCOPe 2.07
  
• d2xaqb1 appears in the current release, SCOPe 2.08