| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family) ![]() Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1 |
| Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein) |
| Protein Demethylase interaction domain of CoREST [267660] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries) |
| Domain d2xaqb1: 2xaq B:308-375 [264585] Other proteins in same PDB: d2xaqa1, d2xaqa2, d2xaqa3, d2xaqb2 complexed with fad, m84 |
PDB Entry: 2xaq (more details), 3.2 Å
SCOPe Domain Sequences for d2xaqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xaqb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev
Timeline for d2xaqb1: