SCOPe 2.08: Domain d2xajb1: 2xaj B:308-375

Lineage for d2xajb1 (2xaj B:308-375)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family)
   Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1

5. Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)

6. Protein Demethylase interaction domain of CoREST [267660] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries)

8. Domain d2xajb1: 2xaj B:308-375 [264580]
   Other proteins in same PDB: d2xaja1, d2xaja2, d2xaja3, d2xajb2
   complexed with fad, tca

Details for d2xajb1

PDB Entry: 2xaj, 3.3 Å

PDB Description: crystal structure of lsd1-corest in complex with (-)-trans-2-phenylcyclopropyl-1-amine

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xajb1:

Sequence; same for both SEQRES and ATOM records:

>d2xajb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

Timeline for d2xajb1:

• d2xajb1 first appeared in SCOPe 2.05
  
• d2xajb1 appears in SCOPe 2.07