Lineage for d2xaja1 (2xaj A:171-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692654Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 2692655Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 2692656Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
    Uniprot O60341 169-279
  8. 2692674Domain d2xaja1: 2xaj A:171-273 [264577]
    Other proteins in same PDB: d2xaja2, d2xaja3, d2xajb1, d2xajb2
    complexed with fad, tca

Details for d2xaja1

PDB Entry: 2xaj (more details), 3.3 Å

PDB Description: crystal structure of lsd1-corest in complex with (-)-trans-2-phenylcyclopropyl-1-amine
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2xaja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xaja1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d2xaja1:

Click to download the PDB-style file with coordinates for d2xaja1.
(The format of our PDB-style files is described here.)

Timeline for d2xaja1: