SCOPe 2.06: Domain d2xagb2: 2xag B:376-440

Lineage for d2xagb2 (2xag B:376-440)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein REST corepressor 1, CoREST [140165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
   Uniprot Q9UKL0 376-440

8. Domain d2xagb2: 2xag B:376-440 [264571]
   Other proteins in same PDB: d2xaga1, d2xaga2, d2xaga3, d2xagb1
   complexed with fad, tcf

Details for d2xagb2

PDB Entry: 2xag, 3.1 Å

PDB Description: crystal structure of lsd1-corest in complex with para-bromo-(-)-trans-2-phenylcyclopropyl-1-amine

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xagb2:

Sequence; same for both SEQRES and ATOM records:

>d2xagb2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

Timeline for d2xagb2:

• d2xagb2 first appeared in SCOPe 2.05
  
• d2xagb2 appears in SCOPe 2.07
  
• d2xagb2 appears in the current release, SCOPe 2.08