Lineage for d2xagb2 (2xag B:376-440)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304761Family a.4.1.3: Myb/SANT domain [46739] (16 protein domains)
  6. 2304816Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 2304817Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
    Uniprot Q9UKL0 376-440
  8. 2304828Domain d2xagb2: 2xag B:376-440 [264571]
    Other proteins in same PDB: d2xaga1, d2xaga2, d2xaga3, d2xagb1
    complexed with fad, tcf

Details for d2xagb2

PDB Entry: 2xag (more details), 3.1 Å

PDB Description: crystal structure of lsd1-corest in complex with para-bromo-(-)-trans-2-phenylcyclopropyl-1-amine
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xagb2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

SCOPe Domain Coordinates for d2xagb2:

Click to download the PDB-style file with coordinates for d2xagb2.
(The format of our PDB-style files is described here.)

Timeline for d2xagb2: